SCOP 1.75: Domain d2qozg1: 2qoz G:1-81

Lineage for d2qozg1 (2qoz G:1-81)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
   Uniprot P02390 1-81! Uniprot P02390 82-176

8. Domain d2qozg1: 2qoz G:1-81 [151120]
   Other proteins in same PDB: d2qoz01, d2qoz11, d2qoz31, d2qoz41, d2qozc1, d2qozc2, d2qozd1, d2qoze1, d2qozf1, d2qozh1, d2qozh2, d2qozi1, d2qozi2, d2qozj1, d2qozk1, d2qozl1, d2qozm1, d2qozn1, d2qozo1, d2qozp1, d2qozq1, d2qozr1, d2qozs1, d2qozt1, d2qozu1, d2qozv1, d2qozw1, d2qozx1, d2qozy1, d2qozz1
   automatically matched to 2AW4 G:1-81
   complexed with mg, nmy, zn

Details for d2qozg1

PDB Entry: 2qoz, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 50S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (G:) 50S ribosomal protein L6

SCOP Domain Sequences for d2qozg1:

Sequence; same for both SEQRES and ATOM records:

>d2qozg1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
srvakapvvvpagvdvkingqvitikgkngeltrtlndavevkhadntltfgprdgyadg
waqagtarallnsmvigvteg

Timeline for d2qozg1:

• d2qozg1 is new in SCOP 1.75
  
• d2qozg1 appears in SCOPe 2.01
  
• d2qozg1 appears in the current release, SCOPe 2.08