![]() | Class j: Peptides [58231] (121 folds) |
![]() | Fold j.122: Ribosomal protein S21p [161307] (1 superfamily) non-globular, mainly alpha-helical |
![]() | Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) ![]() |
![]() | Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein) Pfam PF01165 |
![]() | Protein Ribosomal protein S21, RpsU [161310] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [161311] (24 PDB entries) Uniprot P68679 4-54 |
![]() | Domain d2qoyu1: 2qoy U:3-53 [151110] Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1 automatically matched to 2AVY U:3-53 complexed with mg, nmy, scm |
PDB Entry: 2qoy (more details), 3.5 Å
SCOP Domain Sequences for d2qoyu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoyu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]} ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
Timeline for d2qoyu1: