Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (2 species) |
Species Escherichia coli [TaxId:562] [158351] (24 PDB entries) Uniprot P0A7T7 19-73 |
Domain d2qoyr1: 2qoy R:19-73 [151107] Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoys1, d2qoyt1, d2qoyu1 protein/RNA complex; complexed with mg, nmy, scm protein/RNA complex; complexed with mg, nmy, scm |
PDB Entry: 2qoy (more details), 3.5 Å
SCOPe Domain Sequences for d2qoyr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoyr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]} eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh
Timeline for d2qoyr1: