Lineage for d2mgl__ (2mgl -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 350084Protein Myoglobin [46469] (9 species)
  7. 350157Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (148 PDB entries)
  8. 350271Domain d2mgl__: 2mgl - [15110]
    complexed with hem, so4; mutant

Details for d2mgl__

PDB Entry: 2mgl (more details), 2 Å

PDB Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin

SCOP Domain Sequences for d2mgl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mgl__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d2mgl__:

Click to download the PDB-style file with coordinates for d2mgl__.
(The format of our PDB-style files is described here.)

Timeline for d2mgl__: