SCOPe 2.02: Domain d2qoye2: 2qoy E:9-77

Lineage for d2qoye2 (2qoy E:9-77)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
   Uniprot P0A7W1 9-77

8. Domain d2qoye2: 2qoy E:9-77 [151095]
   Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1, d2qoyu1
   automatically matched to 2AVY E:9-77
   protein/RNA complex; complexed with mg, nmy, scm

Details for d2qoye2

PDB Entry: 2qoy, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2qoye2:

Sequence; same for both SEQRES and ATOM records:

>d2qoye2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

Timeline for d2qoye2:

• d2qoye2 first appeared in SCOP 1.75
  
• d2qoye2 appears in SCOPe 2.01
  
• d2qoye2 appears in SCOPe 2.03
  
• d2qoye2 appears in the current release, SCOPe 2.08