Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
Species Escherichia coli [TaxId:562] [159642] (29 PDB entries) Uniprot P0C018 1-117 |
Domain d2qoxo1: 2qox O:2-117 [151078] Other proteins in same PDB: d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc1, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxi1, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxm1, d2qoxn1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1 protein/RNA complex; complexed with mg, zn protein/RNA complex; complexed with mg, zn |
PDB Entry: 2qox (more details), 3.93 Å
SCOPe Domain Sequences for d2qoxo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoxo1 c.55.4.1 (O:2-117) Ribosomal protein L18 (L18p) {Escherichia coli [TaxId: 562]} dkksarirratrarrklqelgatrlvvhrtprhiyaqviapngsevlvaastvekaiaeq lkytgnkdaaaavgkavaeralekgikdvsfdrsgfqyhgrvqaladaareaglqf
Timeline for d2qoxo1:
View in 3D Domains from other chains: (mouse over for more information) d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc1, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxi1, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxm1, d2qoxn1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1 |