SCOPe 2.05: Domain d2qoxh2: 2qox H:1-58

Lineage for d2qoxh2 (2qox H:1-58)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
   automatically mapped to Pfam PF01281

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
   Uniprot P0A7R1 1-58

8. Domain d2qoxh2: 2qox H:1-58 [151070]
   Other proteins in same PDB: d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc1, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxi1, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxm1, d2qoxn1, d2qoxo1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d2qoxh2

PDB Entry: 2qox, 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2qoxh2:

Sequence; same for both SEQRES and ATOM records:

>d2qoxh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

Timeline for d2qoxh2:

• d2qoxh2 first appeared in SCOP 1.75
  
• d2qoxh2 appears in SCOPe 2.04
  
• d2qoxh2 appears in SCOPe 2.06
  
• d2qoxh2 appears in the current release, SCOPe 2.08