Lineage for d1moda_ (1mod A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301307Protein Myoglobin [46469] (10 species)
  7. 2301477Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
    Uniprot P02185
  8. 2301660Domain d1moda_: 1mod A: [15107]
    complexed with hem, so4; mutant

Details for d1moda_

PDB Entry: 1mod (more details), 2 Å

PDB Description: high-resolution crystal structures of distal histidine mutants of sperm whale myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1moda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moda_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkktgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1moda_:

Click to download the PDB-style file with coordinates for d1moda_.
(The format of our PDB-style files is described here.)

Timeline for d1moda_: