![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
![]() | Protein C-terminal domain of ribosomal protein L2 [50115] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [159027] (27 PDB entries) Uniprot P60422 125-269 |
![]() | Domain d2qoxc1: 2qox C:125-269 [151062] Other proteins in same PDB: d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxi1, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxm1, d2qoxn1, d2qoxo1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1 automatically matched to 2AW4 C:125-269 protein/RNA complex; complexed with mg, zn |
PDB Entry: 2qox (more details), 3.93 Å
SCOPe Domain Sequences for d2qoxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoxc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]} pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv tpwgvqtkgkktrsnkrtdkfivrr
Timeline for d2qoxc1:
![]() Domains from other chains: (mouse over for more information) d2qox01, d2qox11, d2qox31, d2qox41, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxi1, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxm1, d2qoxn1, d2qoxo1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1 |