SCOP 1.75: Domain d2qoxc1: 2qox C:125-269

Lineage for d2qoxc1 (2qox C:125-269)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
   Uniprot P60422 125-269

8. Domain d2qoxc1: 2qox C:125-269 [151062]
   Other proteins in same PDB: d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxi1, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxm1, d2qoxn1, d2qoxo1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1
   automatically matched to 2AW4 C:125-269
   complexed with mg, zn

Details for d2qoxc1

PDB Entry: 2qox, 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOP Domain Sequences for d2qoxc1:

Sequence; same for both SEQRES and ATOM records:

>d2qoxc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

Timeline for d2qoxc1:

• d2qoxc1 is new in SCOP 1.75
  
• d2qoxc1 appears in SCOPe 2.01
  
• d2qoxc1 appears in the current release, SCOPe 2.08