SCOPe 2.06: Domain d2qowu1: 2qow U:3-53

Lineage for d2qowu1 (2qow U:3-53)

1. Root: SCOPe 2.06

2. Class j: Peptides [58231] (133 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d2qowu1: 2qow U:3-53 [151057]
   Other proteins in same PDB: d2qowb1, d2qowc1, d2qowc2, d2qowd1, d2qowe1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qown1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowt1
   protein/RNA complex; complexed with mg, scm
   protein/RNA complex; complexed with mg, scm

Details for d2qowu1

PDB Entry: 2qow, 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2qowu1:

Sequence; same for both SEQRES and ATOM records:

>d2qowu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d2qowu1:

• d2qowu1 first appeared in SCOP 1.75
  
• d2qowu1 appears in SCOPe 2.05
  
• d2qowu1 appears in SCOPe 2.07
  
• d2qowu1 appears in the current release, SCOPe 2.08