Lineage for d2qowu1 (2qow U:3-53)

  1. Root: SCOPe 2.05
  2. 1973804Class j: Peptides [58231] (129 folds)
  3. 1975666Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1975667Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 1975668Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 1975669Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 1975670Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 1975690Domain d2qowu1: 2qow U:3-53 [151057]
    Other proteins in same PDB: d2qowb1, d2qowc1, d2qowc2, d2qowd1, d2qowe1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qown1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowt1
    protein/RNA complex; complexed with mg, scm
    protein/RNA complex; complexed with mg, scm

Details for d2qowu1

PDB Entry: 2qow (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2qowu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qowu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d2qowu1:

Click to download the PDB-style file with coordinates for d2qowu1.
(The format of our PDB-style files is described here.)

Timeline for d2qowu1: