Lineage for d2qowt1 (2qow T:2-86)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763928Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764036Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 764037Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 764038Protein Ribosomal protein S20 [46994] (2 species)
  7. 764039Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. 764061Domain d2qowt1: 2qow T:2-86 [151056]
    Other proteins in same PDB: d2qowb1, d2qowc1, d2qowc2, d2qowd1, d2qowe1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qown1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowu1
    automatically matched to 2AVY T:2-86
    complexed with mg, scm

Details for d2qowt1

PDB Entry: 2qow (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOP Domain Sequences for d2qowt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qowt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
akglihknkaarhkanltaqinkla

SCOP Domain Coordinates for d2qowt1:

Click to download the PDB-style file with coordinates for d2qowt1.
(The format of our PDB-style files is described here.)

Timeline for d2qowt1: