Lineage for d2qowp1 (2qow P:1-80)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900537Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1900538Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1900539Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1900540Protein Ribosomal protein S16 [54567] (3 species)
  7. 1900543Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 1900563Domain d2qowp1: 2qow P:1-80 [151052]
    Other proteins in same PDB: d2qowb1, d2qowc1, d2qowc2, d2qowd1, d2qowe1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qown1, d2qowq1, d2qowr1, d2qows1, d2qowt1, d2qowu1
    protein/RNA complex; complexed with mg, scm
    protein/RNA complex; complexed with mg, scm

Details for d2qowp1

PDB Entry: 2qow (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2qowp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qowp1 d.27.1.1 (P:1-80) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnk

SCOPe Domain Coordinates for d2qowp1:

Click to download the PDB-style file with coordinates for d2qowp1.
(The format of our PDB-style files is described here.)

Timeline for d2qowp1: