Lineage for d2qown1 (2qow N:1-100)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035919Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 3035920Protein Ribosomal protein S14 [57753] (2 species)
  7. 3035921Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
    Uniprot P02370 1-100
  8. 3035941Domain d2qown1: 2qow N:1-100 [151051]
    Other proteins in same PDB: d2qowb1, d2qowc1, d2qowc2, d2qowd1, d2qowe1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowt1, d2qowu1
    protein/RNA complex; complexed with mg, scm
    protein/RNA complex; complexed with mg, scm

    has additional insertions and/or extensions that are not grouped together

Details for d2qown1

PDB Entry: 2qow (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2qown1:

Sequence, based on SEQRES records: (download)

>d2qown1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records): (download)

>d2qown1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

SCOPe Domain Coordinates for d2qown1:

Click to download the PDB-style file with coordinates for d2qown1.
(The format of our PDB-style files is described here.)

Timeline for d2qown1: