Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
Protein Ribosomal protein S9 [54218] (2 species) |
Species Escherichia coli [TaxId:562] [159907] (26 PDB entries) Uniprot P0A7X3 3-129 |
Domain d2qowi1: 2qow I:3-129 [151046] Other proteins in same PDB: d2qowb1, d2qowc1, d2qowc2, d2qowd1, d2qowe1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qown1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowt1, d2qowu1 automatically matched to 2AVY I:3-129 protein/RNA complex; complexed with mg, scm |
PDB Entry: 2qow (more details), 3.93 Å
SCOPe Domain Sequences for d2qowi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qowi1 d.14.1.1 (I:3-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]} nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr rpqfskr
Timeline for d2qowi1: