Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) |
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
Protein Ribosomal protein S6 [54997] (4 species) |
Species Escherichia coli [TaxId:562] [160317] (24 PDB entries) Uniprot P02358 1-100 |
Domain d2qowf1: 2qow F:1-100 [151043] Other proteins in same PDB: d2qowb1, d2qowc1, d2qowc2, d2qowd1, d2qowe1, d2qowe2, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qown1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowt1, d2qowu1 protein/RNA complex; complexed with mg, scm protein/RNA complex; complexed with mg, scm |
PDB Entry: 2qow (more details), 3.93 Å
SCOPe Domain Sequences for d2qowf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qowf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]} mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv lmnveapqevidelettfrfndavirsmvmrtkhavteas
Timeline for d2qowf1: