Lineage for d2qowb1 (2qow B:8-225)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117666Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 2117667Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 2117668Protein Ribosomal protein S2 [52315] (3 species)
  7. 2117678Species Escherichia coli [TaxId:562] [159491] (26 PDB entries)
    Uniprot P0A7V0 8-225
  8. 2117698Domain d2qowb1: 2qow B:8-225 [151037]
    Other proteins in same PDB: d2qowc1, d2qowc2, d2qowd1, d2qowe1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qown1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowt1, d2qowu1
    protein/RNA complex; complexed with mg, scm
    protein/RNA complex; complexed with mg, scm

Details for d2qowb1

PDB Entry: 2qow (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d2qowb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qowb1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
tnsdpdgvdfvipgnddairavtlylgavaatvregrs

SCOPe Domain Coordinates for d2qowb1:

Click to download the PDB-style file with coordinates for d2qowb1.
(The format of our PDB-style files is described here.)

Timeline for d2qowb1: