![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
![]() | Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) ![]() automatically mapped to Pfam PF00238 |
![]() | Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
![]() | Protein Ribosomal protein L14 [50195] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [159078] (29 PDB entries) Uniprot P02411 2-122 |
![]() | Domain d2qovk1: 2qov K:2-122 [151021] Other proteins in same PDB: d2qov01, d2qov11, d2qov31, d2qov41, d2qovc1, d2qovc2, d2qovd1, d2qove1, d2qovf1, d2qovg1, d2qovg2, d2qovh1, d2qovh2, d2qovi1, d2qovi2, d2qovj1, d2qovl1, d2qovm1, d2qovn1, d2qovo1, d2qovp1, d2qovq1, d2qovr1, d2qovs1, d2qovt1, d2qovu1, d2qovv1, d2qovw1, d2qovx1, d2qovy1, d2qovz1 protein/RNA complex; complexed with mg, zn protein/RNA complex; complexed with mg, zn |
PDB Entry: 2qov (more details), 3.93 Å
SCOPe Domain Sequences for d2qovk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qovk1 b.39.1.1 (K:2-122) Ribosomal protein L14 {Escherichia coli [TaxId: 562]} iqeqtmlnvadnsgarrvmcikvlggshrryagvgdiikitikeaiprgkvkkgdvlkav vvrtkkgvrrpdgsvirfdgnacvllnnnseqpigtrifgpvtrelrsekfmkiislape v
Timeline for d2qovk1:
![]() Domains from other chains: (mouse over for more information) d2qov01, d2qov11, d2qov31, d2qov41, d2qovc1, d2qovc2, d2qovd1, d2qove1, d2qovf1, d2qovg1, d2qovg2, d2qovh1, d2qovh2, d2qovi1, d2qovi2, d2qovj1, d2qovl1, d2qovm1, d2qovn1, d2qovo1, d2qovp1, d2qovq1, d2qovr1, d2qovs1, d2qovt1, d2qovu1, d2qovv1, d2qovw1, d2qovx1, d2qovy1, d2qovz1 |