SCOP 1.69: Domain d2mgb__: 2mgb -

Lineage for d2mgb__ (2mgb -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)

8. Domain d2mgb__: 2mgb - [15102]

Details for d2mgb__

PDB Entry: 2mgb, 2 Å

PDB Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin

SCOP Domain Sequences for d2mgb__:

Sequence; same for both SEQRES and ATOM records:

>d2mgb__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkggvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2mgb__:

• d2mgb__ first appeared (with stable ids) in SCOP 1.55
  
• d2mgb__ appears in SCOP 1.67
  
• d2mgb__ appears in SCOP 1.71
  
• d2mgb__ appears in the current release, SCOPe 2.08, called d2mgba_