SCOPe 2.06: Domain d2qovi2: 2qov I:1-72

Lineage for d2qovi2 (2qov I:1-72)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
   Uniprot P0A7J7 1-72

8. Domain d2qovi2: 2qov I:1-72 [151019]
   Other proteins in same PDB: d2qov01, d2qov11, d2qov31, d2qov41, d2qovc1, d2qovc2, d2qovd1, d2qove1, d2qovf1, d2qovg1, d2qovg2, d2qovh1, d2qovh2, d2qovi1, d2qovj1, d2qovk1, d2qovl1, d2qovm1, d2qovn1, d2qovo1, d2qovp1, d2qovq1, d2qovr1, d2qovs1, d2qovt1, d2qovu1, d2qovv1, d2qovw1, d2qovx1, d2qovy1, d2qovz1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d2qovi2

PDB Entry: 2qov, 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 50S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2qovi2:

Sequence; same for both SEQRES and ATOM records:

>d2qovi2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

Timeline for d2qovi2:

• d2qovi2 first appeared in SCOP 1.75
  
• d2qovi2 appears in SCOPe 2.05
  
• d2qovi2 appears in SCOPe 2.07
  
• d2qovi2 appears in the current release, SCOPe 2.08