Lineage for d2qovi2 (2qov I:1-72)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859768Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 859769Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 859770Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 859774Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 859780Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 859797Domain d2qovi2: 2qov I:1-72 [151019]
    Other proteins in same PDB: d2qov01, d2qov11, d2qov31, d2qov41, d2qovc1, d2qovc2, d2qovd1, d2qove1, d2qovf1, d2qovg1, d2qovg2, d2qovh1, d2qovh2, d2qovi1, d2qovj1, d2qovk1, d2qovl1, d2qovm1, d2qovn1, d2qovo1, d2qovp1, d2qovq1, d2qovr1, d2qovs1, d2qovt1, d2qovu1, d2qovv1, d2qovw1, d2qovx1, d2qovy1, d2qovz1
    automatically matched to 2AW4 I:1-72
    complexed with mg, zn

Details for d2qovi2

PDB Entry: 2qov (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 50S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOP Domain Sequences for d2qovi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qovi2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

SCOP Domain Coordinates for d2qovi2:

Click to download the PDB-style file with coordinates for d2qovi2.
(The format of our PDB-style files is described here.)

Timeline for d2qovi2: