Lineage for d2qovh2 (2qov H:1-58)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573862Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2573863Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2573864Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2573865Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2573873Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 2573891Domain d2qovh2: 2qov H:1-58 [151017]
    Other proteins in same PDB: d2qov01, d2qov11, d2qov31, d2qov41, d2qovc1, d2qovc2, d2qovd1, d2qove1, d2qovf1, d2qovg1, d2qovg2, d2qovh1, d2qovi1, d2qovi2, d2qovj1, d2qovk1, d2qovl1, d2qovm1, d2qovn1, d2qovo1, d2qovp1, d2qovq1, d2qovr1, d2qovs1, d2qovt1, d2qovu1, d2qovv1, d2qovw1, d2qovx1, d2qovy1, d2qovz1
    protein/RNA complex; complexed with mg, zn
    protein/RNA complex; complexed with mg, zn

Details for d2qovh2

PDB Entry: 2qov (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 50S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2qovh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qovh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOPe Domain Coordinates for d2qovh2:

Click to download the PDB-style file with coordinates for d2qovh2.
(The format of our PDB-style files is described here.)

Timeline for d2qovh2: