Lineage for d2qovg2 (2qov G:82-176)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978336Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2978337Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2978338Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2978339Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2978356Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 2978392Domain d2qovg2: 2qov G:82-176 [151015]
    Other proteins in same PDB: d2qov01, d2qov11, d2qov31, d2qov41, d2qovc1, d2qovc2, d2qovd1, d2qove1, d2qovf1, d2qovh1, d2qovh2, d2qovi1, d2qovi2, d2qovj1, d2qovk1, d2qovl1, d2qovm1, d2qovn1, d2qovo1, d2qovp1, d2qovq1, d2qovr1, d2qovs1, d2qovt1, d2qovu1, d2qovv1, d2qovw1, d2qovx1, d2qovy1, d2qovz1
    protein/RNA complex; complexed with mg, zn
    protein/RNA complex; complexed with mg, zn

Details for d2qovg2

PDB Entry: 2qov (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 50S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2qovg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qovg2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

SCOPe Domain Coordinates for d2qovg2:

Click to download the PDB-style file with coordinates for d2qovg2.
(The format of our PDB-style files is described here.)

Timeline for d2qovg2: