Lineage for d2qovc2 (2qov C:61-124)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059775Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 2059900Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2059910Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
    Uniprot P60422 3-124
  8. 2059928Domain d2qovc2: 2qov C:61-124 [151010]
    Other proteins in same PDB: d2qov01, d2qov11, d2qov31, d2qov41, d2qovc1, d2qovd1, d2qove1, d2qovf1, d2qovg1, d2qovg2, d2qovh1, d2qovh2, d2qovi1, d2qovi2, d2qovj1, d2qovk1, d2qovl1, d2qovm1, d2qovn1, d2qovo1, d2qovp1, d2qovq1, d2qovr1, d2qovs1, d2qovt1, d2qovu1, d2qovv1, d2qovw1, d2qovx1, d2qovy1, d2qovz1
    protein/RNA complex; complexed with mg, zn
    protein/RNA complex; complexed with mg, zn

Details for d2qovc2

PDB Entry: 2qov (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 50S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2qovc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qovc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

SCOPe Domain Coordinates for d2qovc2:

Click to download the PDB-style file with coordinates for d2qovc2.
(The format of our PDB-style files is described here.)

Timeline for d2qovc2: