Lineage for d106m__ (106m -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44499Protein Myoglobin [46469] (9 species)
  7. 44565Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries)
  8. 44647Domain d106m__: 106m - [15101]

Details for d106m__

PDB Entry: 106m (more details), 1.99 Å

PDB Description: sperm whale myoglobin v68f ethyl isocyanide at ph 9.0

SCOP Domain Sequences for d106m__:

Sequence; same for both SEQRES and ATOM records: (download)

>d106m__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtfltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d106m__:

Click to download the PDB-style file with coordinates for d106m__.
(The format of our PDB-style files is described here.)

Timeline for d106m__: