Lineage for d2qouu1 (2qou U:3-53)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 900961Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 900962Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 900963Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 900964Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 900965Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 900984Domain d2qouu1: 2qou U:3-53 [151004]
    Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1
    automatically matched to 2AVY U:3-53
    complexed with mg, scm

Details for d2qouu1

PDB Entry: 2qou (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOP Domain Sequences for d2qouu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qouu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOP Domain Coordinates for d2qouu1:

Click to download the PDB-style file with coordinates for d2qouu1.
(The format of our PDB-style files is described here.)

Timeline for d2qouu1: