SCOPe 2.06: Domain d2qour1: 2qou R:19-73

Lineage for d2qour1 (2qou R:19-73)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
   Uniprot P0A7T7 19-73

8. Domain d2qour1: 2qou R:19-73 [151001]
   Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qous1, d2qout1, d2qouu1
   protein/RNA complex; complexed with mg, scm
   protein/RNA complex; complexed with mg, scm

Details for d2qour1

PDB Entry: 2qou, 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2qour1:

Sequence; same for both SEQRES and ATOM records:

>d2qour1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

Timeline for d2qour1:

• d2qour1 first appeared in SCOP 1.75
  
• d2qour1 appears in SCOPe 2.05
  
• d2qour1 appears in SCOPe 2.07
  
• d2qour1 appears in the current release, SCOPe 2.08