Lineage for d2qouq1 (2qou Q:3-82)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1125285Protein Ribosomal protein S17 [50304] (3 species)
  7. 1125288Species Escherichia coli [TaxId:562] [159088] (26 PDB entries)
    Uniprot P02373 3-82
  8. 1125305Domain d2qouq1: 2qou Q:3-82 [151000]
    Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qour1, d2qous1, d2qout1, d2qouu1
    automatically matched to 2AVY Q:3-82
    protein/RNA complex; complexed with mg, scm

Details for d2qouq1

PDB Entry: 2qou (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2qouq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qouq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]}
kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
crplsktkswtlvrvvekav

SCOPe Domain Coordinates for d2qouq1:

Click to download the PDB-style file with coordinates for d2qouq1.
(The format of our PDB-style files is described here.)

Timeline for d2qouq1: