Lineage for d1ebca_ (1ebc A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44499Protein Myoglobin [46469] (9 species)
  7. 44565Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries)
  8. 44650Domain d1ebca_: 1ebc A: [15100]

Details for d1ebca_

PDB Entry: 1ebc (more details), 1.8 Å

PDB Description: sperm whale met-myoglobin:cyanide complex

SCOP Domain Sequences for d1ebca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebca_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1ebca_:

Click to download the PDB-style file with coordinates for d1ebca_.
(The format of our PDB-style files is described here.)

Timeline for d1ebca_: