![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) ![]() |
![]() | Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
![]() | Protein Ribosomal protein S14 [57753] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [161162] (24 PDB entries) Uniprot P02370 1-100 |
![]() | Domain d2qoun1: 2qou N:1-100 [150998] Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1 automatically matched to 2AVY N:1-100 complexed with mg, scm |
PDB Entry: 2qou (more details), 3.93 Å
SCOP Domain Sequences for d2qoun1:
Sequence, based on SEQRES records: (download)
>d2qoun1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw
>d2qoun1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr qtgrphgflrkfglsrikvreaamrgeipglkkasw
Timeline for d2qoun1: