![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S12 [50302] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [159087] (25 PDB entries) Uniprot P0A7S3 1-123 |
![]() | Domain d2qoul1: 2qou L:1-123 [150996] Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1 automatically matched to 2AVY L:1-123 protein/RNA complex; complexed with mg, scm |
PDB Entry: 2qou (more details), 3.93 Å
SCOPe Domain Sequences for d2qoul1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoul1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]} atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr pka
Timeline for d2qoul1: