Lineage for d2qouk1 (2qou K:12-128)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 837367Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 837368Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 837458Protein Ribosomal protein S11 [53141] (2 species)
  7. 837459Species Escherichia coli [TaxId:562] [159644] (24 PDB entries)
    Uniprot P0A7R9 12-128
  8. 837478Domain d2qouk1: 2qou K:12-128 [150995]
    Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1
    automatically matched to 2AVY K:12-128
    complexed with mg, scm

Details for d2qouk1

PDB Entry: 2qou (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOP Domain Sequences for d2qouk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qouk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]}
rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv

SCOP Domain Coordinates for d2qouk1:

Click to download the PDB-style file with coordinates for d2qouk1.
(The format of our PDB-style files is described here.)

Timeline for d2qouk1: