Lineage for d2qouh1 (2qou H:2-128)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1467792Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1467793Protein 70S ribosome functional complex [58121] (9 species)
  7. 1467866Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1467889Domain d2qouh1: 2qou H:2-128 [150992]
    Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1
    automatically matched to d1p6gh_
    protein/RNA complex; complexed with mg, scm

Details for d2qouh1

PDB Entry: 2qou (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2qouh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qouh1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
geiicyv

SCOPe Domain Coordinates for d2qouh1:

Click to download the PDB-style file with coordinates for d2qouh1.
(The format of our PDB-style files is described here.)

Timeline for d2qouh1: