Lineage for d2qouh1 (2qou H:2-128)

  1. Root: SCOPe 2.08
  2. Class i: Low resolution protein structures [58117] (25 folds)
  3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. Protein 70S ribosome functional complex [58121] (4 species)
  7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. Domain d2qouh1: 2qou H:2-128 [150992]
    Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1
    protein/RNA complex; complexed with mg, scm
    protein/RNA complex; complexed with mg, scm

Details for d2qouh1

PDB Entry: 2qou (more details), 3.9299999999999997 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2qouh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qouh1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
geiicyv

SCOPe Domain Coordinates for d2qouh1 are not available.

Timeline for d2qouh1: