![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
![]() | Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) ![]() |
![]() | Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
![]() | Protein Ribosomal protein S7 [47975] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [158599] (24 PDB entries) Uniprot P02359 2-151 |
![]() | Domain d2qoug1: 2qou G:2-151 [150991] Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1 automatically matched to 2AVY G:2-151 protein/RNA complex; complexed with mg, scm |
PDB Entry: 2qou (more details), 3.93 Å
SCOPe Domain Sequences for d2qoug1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoug1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan elsdaaenkgtavkkredvhrmaeankafa
Timeline for d2qoug1: