Lineage for d2qouf1 (2qou F:1-100)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416810Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1416811Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1416812Protein Ribosomal protein S6 [54997] (4 species)
  7. 1416815Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 1416832Domain d2qouf1: 2qou F:1-100 [150990]
    Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1
    automatically matched to 2AVY F:1-100
    protein/RNA complex; complexed with mg, scm

Details for d2qouf1

PDB Entry: 2qou (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2qouf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qouf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d2qouf1:

Click to download the PDB-style file with coordinates for d2qouf1.
(The format of our PDB-style files is described here.)

Timeline for d2qouf1: