SCOPe 2.05: Domain d2qoue1: 2qou E:78-158

Lineage for d2qoue1 (2qou E:78-158)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
   Uniprot P0A7W1 78-158

8. Domain d2qoue1: 2qou E:78-158 [150988]
   Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1
   protein/RNA complex; complexed with mg, scm
   protein/RNA complex; complexed with mg, scm

Details for d2qoue1

PDB Entry: 2qou, 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2qoue1:

Sequence; same for both SEQRES and ATOM records:

>d2qoue1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

Timeline for d2qoue1:

• d2qoue1 first appeared in SCOP 1.75
  
• d2qoue1 appears in SCOPe 2.04
  
• d2qoue1 appears in SCOPe 2.06
  
• d2qoue1 appears in the current release, SCOPe 2.08