Lineage for d2qouc2 (2qou C:106-206)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
    Uniprot P0A7V3 106-206
  8. Domain d2qouc2: 2qou C:106-206 [150986]
    Other proteins in same PDB: d2qoub1, d2qouc1, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1
    protein/RNA complex; complexed with mg, scm
    protein/RNA complex; complexed with mg, scm

Details for d2qouc2

PDB Entry: 2qou (more details), 3.9299999999999997 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2qouc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qouc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

SCOPe Domain Coordinates for d2qouc2 are not available.

Timeline for d2qouc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qouc1