Lineage for d2qouc1 (2qou C:1-105)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025652Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1025679Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1025680Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 1025693Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 1025696Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
    Uniprot P0A7V3 1-105
  8. 1025713Domain d2qouc1: 2qou C:1-105 [150985]
    Other proteins in same PDB: d2qoub1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1
    automatically matched to 2AVY C:1-105
    protein/RNA complex; complexed with mg, scm

Details for d2qouc1

PDB Entry: 2qou (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2qouc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qouc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

SCOPe Domain Coordinates for d2qouc1:

Click to download the PDB-style file with coordinates for d2qouc1.
(The format of our PDB-style files is described here.)

Timeline for d2qouc1: