![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
![]() | Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [160236] (24 PDB entries) Uniprot P0A7V3 1-105 |
![]() | Domain d2qouc1: 2qou C:1-105 [150985] Other proteins in same PDB: d2qoub1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1 automatically matched to 2AVY C:1-105 complexed with mg, scm |
PDB Entry: 2qou (more details), 3.93 Å
SCOP Domain Sequences for d2qouc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qouc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]} gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev
Timeline for d2qouc1: