Lineage for d2qo1b2 (2qo1 B:175-317B)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392579Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1392707Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 1392735Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries)
  8. 1392775Domain d2qo1b2: 2qo1 B:175-317B [150975]
    automated match to d1hzpa2
    complexed with d1t, vzz

Details for d2qo1b2

PDB Entry: 2qo1 (more details), 2.6 Å

PDB Description: 2.6 angstrom crystal structure of the complex between 11- (decyldithiocarbonyloxy)-undecanoic acid and mycobacterium tuberculosis fabh.
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d2qo1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qo1b2 c.95.1.2 (B:175-317B) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
gptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramda
agvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplamaellt
tgaakpgdlalligygaglsyaaqvvrmpk

SCOPe Domain Coordinates for d2qo1b2:

Click to download the PDB-style file with coordinates for d2qo1b2.
(The format of our PDB-style files is described here.)

Timeline for d2qo1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qo1b1