SCOP 1.75: Domain d2qo0a2: 2qo0 A:175-317

Lineage for d2qo0a2 (2qo0 A:175-317)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)

6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries)

8. Domain d2qo0a2: 2qo0 A:175-317 [150969]
   automatically matched to d1hzpa2
   complexed with d1t; mutant

Details for d2qo0a2

PDB Entry: 2qo0, 1.85 Å

PDB Description: crystal structure of the complex between the a246f mutant of mycobacterium beta-ketoacyl-acyl carrier protein synthase iii (fabh) and 11-(decyldithiocarbonyloxy)-undecanoic acid

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOP Domain Sequences for d2qo0a2:

Sequence; same for both SEQRES and ATOM records:

>d2qo0a2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
gptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramda
agvrpdqidvfvphqfnsrinellvknlqlrpdavvandiehtgntsaasiplamaellt
tgaakpgdlalligygaglsyaaqvvrm

Timeline for d2qo0a2:

• d2qo0a2 is new in SCOP 1.75
  
• d2qo0a2 appears in SCOPe 2.01
  
• d2qo0a2 appears in the current release, SCOPe 2.08