Lineage for d2qnza1 (2qnz A:-10-174)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846958Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 846959Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 847355Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 847458Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 847486Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries)
  8. 847499Domain d2qnza1: 2qnz A:-10-174 [150964]
    automatically matched to d1hzpa1
    complexed with bme, dfd

Details for d2qnza1

PDB Entry: 2qnz (more details), 2.3 Å

PDB Description: Crystal structure of the complex between the mycobacterium beta-ketoacyl-acyl carrier protein synthase III (FABH) and SS-(2-hydroxyethyl)-O-decyl ester carbono(dithioperoxoic) acid
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOP Domain Sequences for d2qnza1:

Sequence, based on SEQRES records: (download)

>d2qnza1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
fqgi

Sequence, based on observed residues (ATOM records): (download)

>d2qnza1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqsdewiytrtgiktrrfaaddesaasm
ateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagcag
fgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfqgi

SCOP Domain Coordinates for d2qnza1:

Click to download the PDB-style file with coordinates for d2qnza1.
(The format of our PDB-style files is described here.)

Timeline for d2qnza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qnza2