Lineage for d1mlr__ (1mlr -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries) 
Domain d1mlr__: 1mlr - [15096]
Details for d1mlr__
PDB Entry: 1mlr (more details), 2 Å
PDB Description: structural and functional effects of apolar mutations of val68(e11) in myoglobin
SCOP Domain Sequences for d1mlr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mlr__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtlltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg
SCOP Domain Coordinates for d1mlr__:
Click to download the PDB-style file with coordinates for d1mlr__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mlr__:
- d1mlr__ appears in SCOP 1.57
- d1mlr__ appears in the current release, SCOPe 2.08, called d1mlra_
View in 3D