![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
![]() | Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries) |
![]() | Domain d2qnxb2: 2qnx B:175-317B [150959] automated match to d1hzpa2 complexed with mdx, udt |
PDB Entry: 2qnx (more details), 2.7 Å
SCOPe Domain Sequences for d2qnxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qnxb2 c.95.1.2 (B:175-317B) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} gptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramda agvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplamaellt tgaakpgdlalligygaglsyaaqvvrmpk
Timeline for d2qnxb2: