| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein Ketoacyl-ACP synthase III (FabH) [53912] (5 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries) |
| Domain d2qnxa1: 2qnx A:-10-174 [150956] automated match to d1hzpa1 complexed with mdx, udt |
PDB Entry: 2qnx (more details), 2.7 Å
SCOPe Domain Sequences for d2qnxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qnxa1 c.95.1.2 (A:-10-174) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddes
aasmateacrralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsa
gcagfgyalgaaadmirgggaatmlvvgteklsptidmydrgncfifadgaaavvvgetp
fqgi
Timeline for d2qnxa1: