Lineage for d2qnva1 (2qnv A:142-434)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776902Protein Pregnane x receptor, PXR [63624] (1 species)
  7. 776903Species Human (Homo sapiens) [TaxId:9606] [63625] (6 PDB entries)
  8. 776910Domain d2qnva1: 2qnv A:142-434 [150955]
    automatically matched to d1m13a_
    complexed with cdz

Details for d2qnva1

PDB Entry: 2qnv (more details), 2.8 Å

PDB Description: Crystal Structure of the Pregnane X Receptor bound to Colupulone
PDB Compounds: (A:) orphan nuclear receptor pxr

SCOP Domain Sequences for d2qnva1:

Sequence, based on SEQRES records: (download)

>d2qnva1 a.123.1.1 (A:142-434) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgvlssgcelpeslqapsreeaakwsq
vrkdlcslkvslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvi
syfrdlpiedqisllkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqllle
pmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnr
pqpahrflflkimamltelrsinaqhtqrllriqdihpfatplmqelfgitgs

Sequence, based on observed residues (ATOM records): (download)

>d2qnva1 a.123.1.1 (A:142-434) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgvlkvslqlrgedgsvwnykppafsl
lphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgtw
ecgrlsycleqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdql
qeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdihpfatplm
qelfgitgs

SCOP Domain Coordinates for d2qnva1:

Click to download the PDB-style file with coordinates for d2qnva1.
(The format of our PDB-style files is described here.)

Timeline for d2qnva1: