Lineage for d1moa__ (1moa -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 276464Protein Myoglobin [46469] (9 species)
  7. 276535Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (143 PDB entries)
  8. 276627Domain d1moa__: 1moa - [15095]
    complexed with hem, so4; mutant

Details for d1moa__

PDB Entry: 1moa (more details), 1.9 Å

PDB Description: a novel site-directed mutant of myoglobin with an unusually high o2 affinity and low autooxidation rate

SCOP Domain Sequences for d1moa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moa__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1moa__:

Click to download the PDB-style file with coordinates for d1moa__.
(The format of our PDB-style files is described here.)

Timeline for d1moa__: