Lineage for d2qnoa_ (2qno A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004138Protein Processive endocellulase CelF (Cel48F) [48220] (2 species)
  7. 2004139Species Clostridium cellulolyticum [TaxId:1521] [48221] (9 PDB entries)
  8. 2004141Domain d2qnoa_: 2qno A: [150948]
    automated match to d1f9da_
    complexed with ca, sgc; mutant

Details for d2qnoa_

PDB Entry: 2qno (more details), 2 Å

PDB Description: Crystal Structure of the Mutant E55Q of the Cellulase CEL48F in Complex with a Thio-Oligosaccharide
PDB Compounds: (A:) Endoglucanase F

SCOPe Domain Sequences for d2qnoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnoa_ a.102.1.2 (A:) Processive endocellulase CelF (Cel48F) {Clostridium cellulolyticum [TaxId: 1521]}
asspankvyqdrfesmyskikdpangyfseqgipyhsietlmveapdyghvttsqamsyy
mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
qvptqrlhrfwaqsefavangvyailfpd

SCOPe Domain Coordinates for d2qnoa_:

Click to download the PDB-style file with coordinates for d2qnoa_.
(The format of our PDB-style files is described here.)

Timeline for d2qnoa_: